SERMORELIN

Quantity

Clear

Certificate of Analysis

Third-party tested for 99% purity, ID, quantity.

Certificate of Analysis

Third-party tested for endotoxins

5 mg

Synthetic peptide, 29 residues, C-terminal amide. Reference material for in vitro laboratory research use only.

Compound	Sermorelin (GHRH 1–29 amide)
CAS	86168-78-7
Sequence (1-letter)	YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2
Molecular formula	C₁₄₉H₂₄₆N₄₄O₄₂S
Molecular weight	3357.9 g/mol
Net content	5 mg per vial (gross fill; actual content per lot COA)
Form	Lyophilized powder
Storage	?20 °C, sealed and desiccated; hygroscopic
Testing	Identity and purity verified by third-party HPLC analysis; a lot-specific Certificate of Analysis is provided with each order.

Research Use Only. Not a drug, supplement, or food. Not for human or veterinary use. Not intended to diagnose, treat, cure, or prevent any disease.

SERMORELIN Structure

CAS: #86168-78-7
Molecular Formula: C???H???N??O??S
Molecular Weight: 3357.9 g/mol
PubChem ID: 16132308

Research Findings

Sermorelin has been investigated in endocrine, signaling, and experimental models, with research focusing on its ability to modulate somatotroph axis activity, influence downstream cascades, and support structural remodeling mechanisms. Studies also highlight its role in pathway characterization, molecular proliferation, and signaling dynamics in preclinical settings.

Key Areas of Research:

Endocrine: Somatotroph axis, signaling, cascades
Signaling: Lipid pathways, dynamics, markers
Molecular: Proliferation, remodeling, protein synthesis

Together, these findings suggest experimental utility for Sermorelin across multiple biological systems. By engaging endocrine signaling pathways and influencing downstream and remodeling processes, Sermorelin provides a platform for research into molecular dynamics, pathway characterization, and endocrine biology in laboratory settings.

Walker R.F. et al., 1994

References

Walker R.F. et al. (1994). Pharmacokinetics and biological activity of Sermorelin, a GHRH analog, in preclinical models. Metabolism, 43(6): 781–786.

Corpas E. et al. (1992). Endocrine and metabolic effects of Sermorelin in research studies. J Clin Endocrinol Metab, 75(6): 1523–1528.

Our Process

STEP 1

Precision Lyophilization

Manufactured in a controlled U.S. facility under strict compounding standards.

STEP 2

Verified Purity

Every batch third-party tested with HPLC and mass spectrometry.

STEP 3

Same-Day Fulfillment

Orders dispatched same-day from our
U.S. facility.

STEP 1

Precision Lyophilization

Manufactured in a controlled U.S. facility under strict compounding standards.

STEP 2

Verified Purity

Every batch third-party tested with HPLC and mass spectrometry.

STEP 3

Same-Day Fulfillment

Orders dispatched same-day from our
U.S. facility.

Email us, our dedicated team is here to help

Reach out and get a response within minutes.

Frequently Asked Questions

Everything you need to know about our products and processes.

What's the actual amount in each vial?

Each vial contains exactly what’s shown on the label. For example, a 10mg vial has exactly 10mg of lyophilized peptide. Researchers can divide it into smaller portions—like four 2.5mg measurements—but the total amount remains 10mg.

Are additional supplies needed?

Peptides are supplied as lyophilized powder. They do not come reconstituted, and any extra supplies must be sourced separately for research applications.

How long does a vial last?

In lyophilized powder form, peptides stay stable for up to 2 years. After reconstitution, it should be refrigerated and is generally stable for up to 2 months.

Does the product come with instructions?

Products from us do not include usage instructions, as they are strictly for in vitro research and prohibited by law for human or animal use. Misuse or unlawful application will result in permanent denial of service.

How should I store these products?

Lyophilized peptides should be stored away from heat and light. Once reconstituted, they must be refrigerated to maintain stability and efficacy.