Need help? Email us and our team of experts will reply [email protected]

 
 
GLP-1

GLP-1

Certificate of Analysis

Third-party tested for 99% purity, ID, quantity.

Certificate of Analysis

Third-party tested for endotoxins

View COA Document 1
View COA Document 2
View COA Document 1
View COA Document 2
10 mg

Synthetic lipidated peptide, 31 residues. Reference material for in vitro laboratory research use only.

CAS 910463-68-2
Sequence 31 residues, lipidated; see lot Certificate of Analysis
Molecular formula C187H291N45O59
Molecular weight 4113.6 g/mol
Net content 10 mg per vial (gross fill; actual content per lot COA)
Form Lyophilized powder
Storage ?20 °C, desiccated, protected from light
Testing Identity and purity verified by third-party HPLC analysis; a lot-specific Certificate of Analysis is provided with each order.

Research Use Only. Not a drug, supplement, or food. Not for human or veterinary use. Not intended to diagnose, treat, cure, or prevent any disease.

GLP-1 Structure

Commonly referenced form: GLP-1(7–36) amide
Sequence: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR
Molecular Formula: C???H???N??O??
Molecular Weight: 3297.6 g/mol
PubChem CID: 16133831
CAS: 107444-51-9

Research Findings

GLP-1 has been extensively investigated for its role in several interconnected physiological signaling pathways.

Key Areas of Research:

  • Incretin Signaling: Glucose-dependent insulin secretion and pancreatic signaling
  • Glucagon Regulation: Modulation of glucagon secretion under glucose-dependent conditions
  • Gastrointestinal Signaling: Research into gastric emptying and gastrointestinal function
  • Appetite Signaling: Investigation of pathways associated with food intake and energy regulation
  • Metabolic Signaling: Study of GLP-1 receptor-mediated signaling and glucose homeostasis
Together, these findings have established GLP-1 as an important subject of research in endocrinology, metabolism, gastrointestinal physiology, and receptor signaling.

References

PubChem — Glucagon-Like Peptide 1.

PubChem — Glucagon-like Peptide 1 (Human, 7–36 Amide).

PubChem — Glucagon-like Peptide 1 (7–36) amide.

Our Process

View Products

STEP 1

Precision Lyophilization

Manufactured in a controlled U.S. facility under strict compounding standards.

STEP 2

Verified Purity

Every batch third-party tested with HPLC and mass spectrometry.

STEP 3

Same-Day Fulfillment

Orders dispatched same-day from our
U.S. facility.

STEP 1

Precision Lyophilization

Manufactured in a controlled U.S. facility under strict compounding standards.

STEP 2

Verified Purity

Every batch third-party tested with HPLC and mass spectrometry.

STEP 3

Same-Day Fulfillment

Orders dispatched same-day from our
U.S. facility.

Email us, our dedicated team is here to help

Reach out and get a response within minutes.

Email Us

Frequently Asked Questions

Everything you need to know about our products and processes.

View Products

Each vial contains exactly what’s shown on the label. For example, a 10mg vial has exactly 10mg of lyophilized peptide. Researchers can divide it into smaller portions—like four 2.5mg measurements—but the total amount remains 10mg.

 
Peptides are supplied as lyophilized powder. They do not come reconstituted, and any extra supplies must be sourced separately for research applications.
 
 
In lyophilized powder form, peptides stay stable for up to 2 years. After reconstitution, it should be refrigerated and is generally stable for up to 2 months.
 
 
Products from us do not include usage instructions, as they are strictly for in vitro research and prohibited by law for human or animal use. Misuse or unlawful application will result in permanent denial of service.
 
 
Lyophilized peptides should be stored away from heat and light. Once reconstituted, they must be refrigerated to maintain stability and efficacy.